COG449 (OP449), PP2A activator and SET inhibitor
COG449 (OP449) Peptide – PP2A Activator & SET Inhibitor for Anti-Cancer Research
Product Name: COG449 (OP449)
Synonyms: OP449, SET Inhibitor, PP2A Activator
Sequence:
(Ac-RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL-NH2)-BMOE-(Ac-RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL-NH2)
Molecular Formula: C₄₀₄H₆₉₄N₁₄₂O₇₆S₄
Molecular Weight: 9223 g/mol
CAS Number: Not Available
Purity: >98%
Appearance: White to off-white powder
Application: For research use only
Storage: −20°C (long term), sealed and protected from light and moisture
Shipping: Ambient (domestic); varies for international orders
What is COG449 (OP449)?
COG449, also referred to as OP449, is a synthetic cell-penetrating peptide originally developed by Cognosci, Inc. and later advanced by Oncotide Pharmaceuticals. This research-grade peptide is a SET inhibitor that works by disrupting intracellular interactions critical for tumor survival and progression.
Mechanism of Action
COG449 targets and inhibits the SET oncoprotein, which is known to suppress the activity of protein phosphatase 2A (PP2A a well-established tumor suppressor. By blocking SET, COG449 peptide activates PP2A, potentially restoring its function in downregulating cancer-promoting pathways.
This peptide is being explored for its effects in anti-cancer research, especially in hematologic malignancies and drug-resistant solid tumors.
COG449 OP449 Peptide Benefits
● SET Inhibition: Restores tumor suppressor activity of PP2A
● PP2A Activation: Reactivates cellular control mechanisms over oncogenic signaling
● Enhances Drug Sensitivity: Potentially improves efficacy of tyrosine kinase inhibitors
● Preclinical Tumor Suppression: Shown to inhibit tumor cell proliferation in multiple cancer models
COG449 PP2A Activator Uses in Cancer Research
● Leukemia Studies: Shows promise in suppressing cell viability in AML and CML models
● Lymphoma Research: Investigated for effects in Burkitt’s lymphoma
● Oral Squamous Cell Carcinoma Models: Demonstrates ability to interfere with tumor progression
● Drug Resistance Investigations: Explored in combination therapies targeting tyrosine kinase resistance
Chemical Specifications
|
Property |
Details |
|
Peptide Sequence |
(RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL)₂ |
|
Molecular Formula |
C₄₀₄H₆₉₄N₁₄₂O₇₆S₄ |
|
Molecular Weight |
9223 g/mol |
|
Purity |
>98% |
|
Form |
Lyophilized Powder |
|
Color |
White to off-white |
Buy COG449 PP2A Activator Online
Looking to buy COG449 OP449 peptide online for your laboratory or institution? We supply high-purity COG449 peptide designed for advanced cancer and cell signaling research. Bulk quantities and custom packaging available for academic, biotech, or pharmaceutical research.
Important Note
COG449 is not intended for human or veterinary use. It is strictly for laboratory research purposes. The safety and efficacy in humans have not been established, and it has not received regulatory approval as a therapeutic agent.