COG449 (OP449), PP2A activator and SET inhibitor

COG449 (OP449), PP2A activator and SET inhibitor

2 mg
$289.00
Skip to product information
COG449 (OP449), PP2A activator and SET inhibitor

COG449 (OP449), PP2A activator and SET inhibitor

$289.00
Size

COG449 (OP449) Peptide – PP2A Activator & SET Inhibitor for Anti-Cancer Research

Product Name: COG449 (OP449)
 Synonyms: OP449, SET Inhibitor, PP2A Activator
 Sequence:

(Ac-RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL-NH2)-BMOE-(Ac-RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL-NH2)

 Molecular Formula: C₄₀₄H₆₉₄N₁₄₂O₇₆S
 Molecular Weight: 9223 g/mol
 CAS Number: Not Available
 Purity: >98%
 Appearance: White to off-white powder
 Application: For research use only
 Storage: −20°C (long term), sealed and protected from light and moisture
 Shipping: Ambient (domestic); varies for international orders

What is COG449 (OP449)?

COG449, also referred to as OP449, is a synthetic cell-penetrating peptide originally developed by Cognosci, Inc. and later advanced by Oncotide Pharmaceuticals. This research-grade peptide is a SET inhibitor that works by disrupting intracellular interactions critical for tumor survival and progression.

Mechanism of Action

COG449 targets and inhibits the SET oncoprotein, which is known to suppress the activity of protein phosphatase 2A (PP2A a well-established tumor suppressor. By blocking SET, COG449 peptide activates PP2A, potentially restoring its function in downregulating cancer-promoting pathways.

This peptide is being explored for its effects in anti-cancer research, especially in hematologic malignancies and drug-resistant solid tumors.

COG449 OP449 Peptide Benefits

     SET Inhibition: Restores tumor suppressor activity of PP2A

     PP2A Activation: Reactivates cellular control mechanisms over oncogenic signaling

     Enhances Drug Sensitivity: Potentially improves efficacy of tyrosine kinase inhibitors

     Preclinical Tumor Suppression: Shown to inhibit tumor cell proliferation in multiple cancer models

COG449 PP2A Activator Uses in Cancer Research

     Leukemia Studies: Shows promise in suppressing cell viability in AML and CML models

     Lymphoma Research: Investigated for effects in Burkitt’s lymphoma

     Oral Squamous Cell Carcinoma Models: Demonstrates ability to interfere with tumor progression

     Drug Resistance Investigations: Explored in combination therapies targeting tyrosine kinase resistance

Chemical Specifications

Property

Details

Peptide Sequence

(RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL)

Molecular Formula

C₄₀₄H₆₉₄N₁₄₂O₇₆S

Molecular Weight

9223 g/mol

Purity

>98%

Form

Lyophilized Powder

Color

White to off-white

 

Buy COG449 PP2A Activator Online

Looking to buy COG449 OP449 peptide online for your laboratory or institution? We supply high-purity COG449 peptide designed for advanced cancer and cell signaling research. Bulk quantities and custom packaging available for academic, biotech, or pharmaceutical research.

Important Note

COG449 is not intended for human or veterinary use. It is strictly for laboratory research purposes. The safety and efficacy in humans have not been established, and it has not received regulatory approval as a therapeutic agent.

 

You may also like